Analytical Data
-
Gene name
TAF5L
- Application
-
Alternative Names
TAF5L；PAF65B；TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75529
-
Expression Region
1-325aa
-
AA Sequence
MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
-
Molecular Weight
64.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAF5L, or TATA-box binding protein-associated factor 5-like protein, is a member of the TAF family, which is crucial in the transcription process as part of the RNA polymerase II transcription complex. Recent research highlights its role in modulating gene expression and its involvement in various cellular processes, including cell differentiation and proliferation. The study of TAF5L has gained attention due to its potential implications in developmental biology and cancer research, where altered expression levels or mutations in transcription factors can lead to malignant transformation. The recombinant expression of TAF5L in laboratory settings enables the in-depth examination of its functional properties, interactions with other protein complexes, and effects on target genes. Investigating TAF5L through recombinant protein techniques can provide insights into its biological significance and uncover potential therapeutic targets for diseases associated with transcriptional dysregulation. Understanding its structure and function may pave the way for novel strategies in gene therapy and regenerative medicine, ultimately contributing to the broader knowledge of transcriptional regulation mechanisms.
