Analytical Data
-
Gene name
PTPNS1L2
- Application
-
Alternative Names
SIRPD; PTPNS1L2; Signal-regulatory protein delta; SIRP-delta; Protein tyrosine phosphatase non-receptor type substrate 1-like 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H106
-
Expression Region
30-197 aa
-
AA Sequence
FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPNS1L2, a member of the protein tyrosine phosphatase family, has garnered attention due to its potential roles in various cellular processes, including signal transduction, cell growth, and differentiation. Research into PTPNS1L2 is particularly relevant in the context of cancer biology, as abnormal regulation of tyrosine phosphorylation is linked to tumorigenesis and cancer progression. Despite its significance, the precise biological functions and mechanisms of action of PTPNS1L2 remain poorly understood. Recent studies suggest that PTPNS1L2 may interact with specific signaling pathways involved in oncogenesis, contributing to both tumor suppression and promotion, depending on the cellular context. Additionally, PTPNS1L2’s expression patterns across different tissues and its potential involvement in immune responses further emphasize the need for comprehensive studies. Understanding the molecular functions and regulatory networks of PTPNS1L2 could provide valuable insights into its role in health and disease, potentially leading to novel therapeutic strategies for cancer and other disorders associated with dysregulated phosphorylation. This highlights the urgency for focused research on the recombinant expression and characterization of PTPNS1L2, as such efforts will contribute to elucidating its functions and therapeutic potential.
