Analytical Data
-
Gene name
SUPT4H1
- Application
-
Alternative Names
SUPT4H1；SPT5；SPT5H；Transcription elongation factor SPT5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63272
-
Expression Region
1-117aa
-
AA Sequence
ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SUPT4H1, also known as suppressor of Ty 4 homolog 1, is a protein that plays a crucial role in the regulation of transcription and RNA processing. It is a component of the elongator complex, which is essential for the transcriptional elongation of RNA Polymerase II and is involved in the modification of histones. Research into SUPT4H1 has gained prominence due to its implications in various biological processes, including cell cycle regulation and gene expression. Recent studies have suggested that alterations in SUPT4H1 levels can lead to dysregulation of these processes, potentially contributing to the pathogenesis of several diseases, including cancer. The recombinant expression of SUPT4H1 allows for the investigation of its structural and functional properties, facilitating a better understanding of its role in cellular mechanisms. Furthermore, characterizing the interactions of SUPT4H1 with other proteins and molecules can provide insights into its involvement in transcriptional regulation and its potential as a therapeutic target. As a result, the study of SUPT4H1 recombinant proteins is integral to advancing our knowledge of gene expression regulation and its broader implications in human health and disease.
