Cat: PA2000-2235

Recombinant Human SUPT4H1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SUPT4H1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SUPT4H1;SPT5;SPT5H;Transcription elongation factor SPT5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63272

  • Expression Region

    1-117aa

  • AA Sequence

    ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

  • Molecular Weight

    40.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SUPT4H1, also known as suppressor of Ty 4 homolog 1, is a protein that plays a crucial role in the regulation of transcription and RNA processing. It is a component of the elongator complex, which is essential for the transcriptional elongation of RNA Polymerase II and is involved in the modification of histones. Research into SUPT4H1 has gained prominence due to its implications in various biological processes, including cell cycle regulation and gene expression. Recent studies have suggested that alterations in SUPT4H1 levels can lead to dysregulation of these processes, potentially contributing to the pathogenesis of several diseases, including cancer. The recombinant expression of SUPT4H1 allows for the investigation of its structural and functional properties, facilitating a better understanding of its role in cellular mechanisms. Furthermore, characterizing the interactions of SUPT4H1 with other proteins and molecules can provide insights into its involvement in transcriptional regulation and its potential as a therapeutic target. As a result, the study of SUPT4H1 recombinant proteins is integral to advancing our knowledge of gene expression regulation and its broader implications in human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US