Analytical Data
-
Gene name
PTPLAD1
- Application
-
Alternative Names
HACD3; BIND1; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Butyrate-induced protein 1; B-ind1; hB-ind1; Protein-tyrosine phosphatase-like A domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P035
-
Expression Region
1-362 aa
-
AA Sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK IH
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPLAD1, or Protein Tyrosine Phosphatase-Like Domain Containing 1, is a member of the protein tyrosine phosphatase (PTP) family, which plays crucial roles in regulating various cellular processes, including cell growth, differentiation, and signaling pathways. Research into PTPLAD1 has gained attention due to its potential implications in cancer biology and other diseases, as alterations in tyrosine phosphorylation are often linked to tumorigenesis and metastasis. The protein features a phosphatase-like domain, suggesting it may be involved in dephosphorylating specific substrates, thereby influencing various signaling cascades. Studies indicate that PTPLAD1 might interact with key signaling proteins, modulating pathways such as those involving receptor tyrosine kinases (RTKs) and phosphoinositide 3-kinase (PI3K). Understanding the molecular mechanisms of PTPLAD1 might provide insights into its role in disease processes, especially in cancer, where aberrant signaling is a common hallmark. Additionally, the recombinant expression of PTPLAD1 could facilitate the investigation of its biochemical properties and interactions, paving the way for potential therapeutic interventions targeting its function or modulation of its pathways. Therefore, elucidating the roles and mechanisms of PTPLAD1 through studies on its recombinant protein may enhance our understanding of its physiological significance and establish its potential as a therapeutic target in cancer treatment and other pathological conditions.
