Analytical Data
-
Gene name
PDGFRB
- Application
-
Alternative Names
PDGFRB;PTP2C;SHPTP2;Tyrosine-Protein phosphatase non-receptor type 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09619
-
Expression Region
901-1106aa
-
AA Sequence
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL
-
Molecular Weight
54.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Platelet-derived growth factor receptor beta (PDGFRB) is a crucial receptor tyrosine kinase involved in a variety of physiological and pathological processes, including cell proliferation, differentiation, and survival. It primarily binds to platelet-derived growth factors (PDGFs), which are key regulators of mesenchymal and vascular development. Dysregulation of PDGFRB signaling is implicated in numerous diseases, particularly fibrotic disorders and cancers, making it an attractive target for therapeutic interventions. Recent studies have focused on the structural characterization and functional analysis of PDGFRB to develop targeted therapies that can inhibit its aberrant signaling pathways. The generation of recombinant PDGFRB proteins has facilitated such research by providing a tool for studying its interactions with ligands and downstream signaling molecules. These recombinant proteins can be utilized in various assays to elucidate their role in disease mechanisms and to screen for potential inhibitors that could serve as medicines. Given the receptor's significance in both normal development and disease pathology, understanding its biology offers promising avenues for novel treatment strategies aimed at conditions where PDGFRB is a contributing factor.











