Analytical Data
-
Gene name
C17orf48
- Application
-
Alternative Names
ADPRM; C17orf48; MDS006; Nbla03831Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase; EC 3.6.1.13; EC 3.6.1.16; EC 3.6.1.53
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3LIE5
-
Expression Region
1-205aa
-
AA Sequence
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGELFL
-
Molecular Weight
50.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C17orf48, also known as the cancer/testis antigen, has garnered significant attention in recent years due to its potential role in tumorigenesis and immune response. As a member of the cancer/testis antigen family, C17orf48 is predominantly expressed in testicular tissues and various tumors, making it an attractive target for cancer immunotherapy. Research into C17orf48 has revealed its involvement in cellular processes such as proliferation, differentiation, and apoptosis, suggesting that it may play a pivotal role in the development and progression of certain cancers. Furthermore, studies have shown that C17orf48 exhibits immunogenic properties, which could stimulate an anti-tumor immune response. This has led to increased interest in the development of recombinant protein variants of C17orf48 for use in novel therapeutic strategies, including cancer vaccines and adoptive cell therapies. Understanding the structure, function, and expression patterns of C17orf48 through the analysis of its recombinant protein forms can provide insights into its mechanisms in cancer biology and pave the way for innovative treatments targeting this antigen. As such, the investigation of C17orf48-recombinant proteins not only holds promise for advancing fundamental cancer research but also for developing effective immunotherapeutic applications in clinical settings.
