Analytical Data
-
Gene name
SLC1A6
- Application
-
Alternative Names
SLC1A6；EAAT4；Excitatory amino acid transporter 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48664
-
Expression Region
149-271aa
-
AA Sequence
MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL
-
Molecular Weight
40.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC1A6, also known as the neuronal high-affinity glutamate transporter EAAC1, is a member of the solute carrier family that plays a crucial role in maintaining glutamate homeostasis in the central nervous system. Glutamate is the primary excitatory neurotransmitter in the brain, and its dysregulation is implicated in various neurological disorders, including epilepsy, schizophrenia, and neurodegenerative diseases. The SLC1A6 transporter is responsible for the uptake of glutamate from the synaptic cleft into neurons and surrounding glial cells, thus preventing excitotoxicity and ensuring proper synaptic function. Research on SLC1A6 has gained momentum due to its potential as a target for therapeutic interventions aimed at modulating glutamate levels in the brain. The recombinant expression of SLC1A6 protein in cellular systems is essential for elucidating its functional properties and regulatory mechanisms. Studies have demonstrated that understanding the structure-function relationship of this transporter can provide insights into its role in glutamate signaling and highlight the potential for developing drugs that can enhance or inhibit its activity. Furthermore, investigating the molecular dynamics and conformational states of SLC1A6 can lead to a deeper understanding of its transport mechanism, ultimately contributing to the development of strategies to mitigate glutamate-related pathologies. Thus, SLC1A6 recombinant protein research is crucial not only for basic neurobiology but also for the advancement of therapeutic approaches targeting glutamate-mediated excitotoxicity in neurological diseases.
