Analytical Data
-
Gene name
RPA3
- Application
-
Alternative Names
RPA3；REPA3；RPA14；Replication Protein A 14 kDa subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35244
-
Expression Region
1-119aa
-
AA Sequence
MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ
-
Molecular Weight
40.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPA3, a critical component of the Replication Protein A (RPA) complex, plays a vital role in DNA replication, repair, and recombination processes. RPA is a single-stranded DNA-binding protein essential for maintaining genomic stability, as it ensures the proper functioning of DNA metabolic processes. The RPA complex consists of three subunits—RPA1, RPA2, and RPA3—with RPA3 contributing to the complex's structural integrity and function. Recent studies have highlighted the importance of RPA3 in recognizing and binding to single-stranded DNA during various cellular responses to DNA damage. Its interaction with other proteins involved in the DNA damage response pathway underscores its role in maintaining cellular homeostasis and preventing genomic instability, which can lead to diseases such as cancer. Moreover, research has shown that RPA3 is involved in modulating cellular signaling pathways, thus influencing the overall cellular response to stress. Understanding the structural and functional aspects of RPA3, particularly through studies on its recombinant protein, provides insights into its mechanisms of action and potential as a therapeutic target. As the exploration of RPA3 continues to unfold, it presents opportunities for advancing our knowledge of DNA repair mechanisms and developing novel strategies for cancer treatment.
