Cat: PA1000-5173

Recombinant Human MYOZ2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MYOZ2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MYOZ2;C4orf5;Myozenin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NPC6

  • Expression Region

    1-264aa

  • AA Sequence

    MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHL SNRGARLFKMRQRRSDKYTFENFQYQSRA QINHSIAMQNGKVDGSNLE GGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYY QSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKA SRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVI TTEPTDDTTVPESEDLLEHHHHHH

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MYOZ2, a member of the myozenin family, is primarily expressed in skeletal muscle and plays a crucial role in linking myofibrils and the sarcoplasmic reticulum, thus contributing to muscle contraction and maintenance. Recent studies have suggested that MYOZ2 may have significant implications in muscle development, repair, and overall muscle function. Abnormalities in MYOZ2 expression have been associated with various muscular disorders, making it a potential biomarker for muscle-related diseases. Researchers have increasingly focused on the recombinant production of MYOZ2 to analyze its structure-function relationships and to explore its role in cellular mechanisms involved in muscle physiology. By utilizing recombinant DNA technology, scientists can produce MYOZ2 in controlled laboratory settings, allowing for detailed functional assays, interaction studies, and potential therapeutic applications. Understanding the dynamics of MYOZ2 through recombinant protein studies could provide insights into muscle pathologies and contribute to the development of targeted therapies for muscle degenerative diseases, thereby enhancing recovery strategies and muscle health in various clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US