Analytical Data
-
Gene name
PRR7
- Application
-
Alternative Names
Proline rich protein 7; Proline-rich protein 7; Prr7; PRR7_HUMAN; Synaptic proline rich membrane protein; Synaptic proline-rich membrane protein; transmembrane adaptor protein 3; TRAP3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TB68
-
Expression Region
1-274 aa
-
AA Sequence
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRR7 (Pseudoresponse Regulator 7) is a member of the PRR family of proteins, which are integral to the regulation of circadian rhythms and various developmental processes in plants. Studies have shown that PRR7 plays a crucial role in managing photoperiodic responses, influencing flowering time and seasonal growth adaptations. This protein acts as a central component in the intricate signaling pathways that synchronize plant physiology with environmental cues, particularly light. Research on PRR7 has gained traction due to its potential implications in enhancing crop yields and resilience against climate variability. With the ongoing global challenges of food security and climate change, understanding the molecular mechanisms governing PRR7's function offers valuable insights. It could lead to biotechnological advancements, enabling the development of crops that are better adapted to changing environments. Recent advancements in protein engineering and recombinant DNA technology have made it possible to produce PRR7 as a recombinant protein, allowing for detailed studies of its structure, function, and interactions. This research not only sheds light on fundamental plant biology but also presents opportunities for innovative agricultural practices aimed at improving crop performance under diverse conditions.
