Analytical Data
-
Gene name
MOB1A
- Application
-
Alternative Names
MOB1A；MOB4A；MOBKL1A；MOB kinase activator 1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H8S9
-
Expression Region
2-216aa
-
AA Sequence
SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
-
Molecular Weight
40.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOB1A, a key regulator in the Hippo signaling pathway, has garnered significant attention in recent years due to its critical role in cellular processes such as proliferation, apoptosis, and organ size control. The Hippo pathway is crucial for maintaining tissue homeostasis and preventing tumorigenesis, with MOB1A functioning as a coactivator for the Large Tumor Suppressor (LATS) kinases. Dysregulation of this pathway, including aberrations in MOB1A, is implicated in various cancers, making it a promising target for therapeutic interventions. Research involving recombinant MOB1A protein has enabled scientists to better understand its structural and functional properties, paving the way for potential applications in cancer treatment and regenerative medicine. Furthermore, studies utilizing MOB1A recombinantly expressed in different systems have shed light on its interactions with upstream regulators and downstream effectors, aiding in the elucidation of the complex signaling networks involved in cell growth and development. This growing body of work underscores the importance of MOB1A in cell biology and its potential as a biomarker or therapeutic target in oncology.
