Analytical Data
-
Gene name
C15orf43
- Application
-
Alternative Names
TERB2; C15orf43; Telomere repeats-binding bouquet formation Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHR7
-
Expression Region
1-220aa
-
AA Sequence
MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAKIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIRTPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK
-
Molecular Weight
51.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C15orf43, also known as RGN, is a gene located on chromosome 15 that encodes a protein involved in various cellular processes. Studies have shown that C15orf43 may play a significant role in cellular stress response and may interact with several signaling pathways, making it a candidate for investigation in various diseases, including neurodegenerative disorders and cancer. Its precise biological function is not fully elucidated, prompting researchers to explore the potential of recombinant C15orf43 protein as a tool for understanding its mechanisms of action. Recombinant proteins are essential for studying protein interactions, structure, and function. By producing C15orf43 as a recombinant protein, researchers aim to investigate its biochemical properties, including its structure, stability, and potential post-translational modifications. Understanding the role of C15orf43 could provide insights into its involvement in disease pathways and identify it as a potential biomarker or therapeutic target. Additionally, elucidating the functions of this protein at the molecular level could contribute significantly to the overall understanding of cellular homeostasis and disease mechanisms, highlighting the importance of C15orf43 in biomedical research. As such, studies on recombinant C15orf43 are aimed not only at characterizing the protein itself but also at unraveling its potential implications in health and disease.
