Analytical Data
-
Gene name
CTSV
- Application
-
Alternative Names
CTSV；CATL2；CTSL2；CTSU；Cathepsin L2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60911
-
Expression Region
18-334aa
-
AA Sequence
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSV, or Cathepsin V, is a cysteine protease belonging to the papain family of proteolytic enzymes and has garnered substantial attention in biomedical research due to its critical role in various physiological and pathological processes. This enzyme is predominantly expressed in the immune system and has been implicated in the regulation of immune responses, tissue remodeling, and tumor progression. The study of CTSV and its recombinant protein variants has potential implications in therapeutic applications, particularly in cancer treatment and autoimmune diseases, as it may influence cell migration, apoptosis, and antigen presentation. Understanding the structure-function relationships of CTSV through recombinant protein technology allows researchers to explore its enzymatic mechanisms and substrate specificity in detail, opening avenues for targeted drug design. Moreover, advancements in recombinant DNA technology enable the production of high yields of active CTSV, facilitating large-scale studies and potential clinical applications. As the research progresses, the characterization of CTSV as a biomarker and its utility in diagnostic or therapeutic strategies continues to be a compelling area of investigation, with the promise of enhancing our understanding of proteolytic regulation in health and disease. Given its multifaceted roles in cellular processes, further exploration of CTSV at the molecular level may unveil novel insights into its potential as a therapeutic target, paving the way for innovative treatments in various conditions, including cancer, fibrosis, and immune-related disorders.
