Analytical Data
-
Gene name
RANBP2
- Application
-
Alternative Names
RANBP2；NUP358；E3 SUMO-Protein ligase RanBP2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49792
-
Expression Region
2601-2802aa
-
AA Sequence
PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
-
Molecular Weight
24.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RANBP2 (Ran Binding Protein 2) is a crucial protein that plays a significant role in various cellular processes, particularly in nucleocytoplasmic transport, regulation of gene expression, and maintaining cell cycle progression. It is a multifunctional protein that interacts with the Ran GTPase, which is essential for the transport of proteins and RNA across the nuclear envelope. RANBP2 is implicated in several pathological conditions, including cancer, due to its involvement in cell proliferation and survival pathways. The study of recombinant RANBP2 protein has garnered attention in recent years as researchers seek to elucidate its precise functions and regulatory mechanisms in cellular processes. By producing recombinant RANBP2, scientists can explore its interactions with other cellular molecules, characterizing its role in various signaling pathways and its potential implications in disease. Understanding RANBP2's function at a molecular level may provide insights into therapeutic targets for diseases where this protein is dysregulated. Furthermore, the recombinant protein serves as a valuable tool for biochemical assays, functional studies, and high-throughput screening endeavors aimed at discovering small molecules that can modulate RANBP2 activity. Overall, the ongoing research into recombinant RANBP2 is crucial for advancing our knowledge of cell biology and developing potential treatments for related disorders.
