Cat: PA2000-2177

Recombinant Human RANBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RANBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RANBP2;NUP358;E3 SUMO-Protein ligase RanBP2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49792

  • Expression Region

    2601-2802aa

  • AA Sequence

    PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS

  • Molecular Weight

    24.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RANBP2 (Ran Binding Protein 2) is a crucial protein that plays a significant role in various cellular processes, particularly in nucleocytoplasmic transport, regulation of gene expression, and maintaining cell cycle progression. It is a multifunctional protein that interacts with the Ran GTPase, which is essential for the transport of proteins and RNA across the nuclear envelope. RANBP2 is implicated in several pathological conditions, including cancer, due to its involvement in cell proliferation and survival pathways. The study of recombinant RANBP2 protein has garnered attention in recent years as researchers seek to elucidate its precise functions and regulatory mechanisms in cellular processes. By producing recombinant RANBP2, scientists can explore its interactions with other cellular molecules, characterizing its role in various signaling pathways and its potential implications in disease. Understanding RANBP2's function at a molecular level may provide insights into therapeutic targets for diseases where this protein is dysregulated. Furthermore, the recombinant protein serves as a valuable tool for biochemical assays, functional studies, and high-throughput screening endeavors aimed at discovering small molecules that can modulate RANBP2 activity. Overall, the ongoing research into recombinant RANBP2 is crucial for advancing our knowledge of cell biology and developing potential treatments for related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US