Cat: PA1000-5127

Recombinant Human CASP14 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CASP14

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CASP14;Caspase-14

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P31944

  • Expression Region

    153-240aa

  • AA Sequence

    KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

  • Molecular Weight

    37.2kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CASP14, or Caspase-14, is a member of the caspase family of cysteine proteases, which play crucial roles in various cellular processes, including apoptosis, inflammation, and differentiation. Unlike other caspases that are primarily involved in programmed cell death, CASP14 is implicated in skin homeostasis and the terminal differentiation of keratinocytes. Its expression is notably higher in epithelial tissues, where it is believed to contribute to the proteolytic maturation of key proteins in the skin barrier. Current research has focused on the functional characterization of CASP14, its potential role in skin-related diseases, and its involvement in the immune response. The study of recombinant CASP14 protein has gained traction as it enables researchers to investigate its enzymatic activity, structural properties, and interactions with substrates. Understanding CASP14 at a molecular level may shed light on its unique functions in skin biology and contribute to the development of therapeutic strategies for disorders such as atopic dermatitis, psoriasis, and wound healing. By exploring the biochemical pathways involving CASP14 and its regulatory mechanisms, scientists hope to uncover novel insights that could lead to targeted treatments and a deeper understanding of skin health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US