Analytical Data
-
Gene name
PRPF4B
- Application
-
Alternative Names
dJ1013A10.1 (PRP4 protein kinase homolog); dJ1013A10.1; KIAA0536; PR4H; Protein serine/threonine kinase; PRP4; PRP4 kinase; PRP4 pre mRNA processing factor 4 homolog; PRP4 pre mRNA processing factor 4 homolog B (yeast); PRP4 pre-mRNA-processing factor 4 homolog; PRP4B_HUMAN; PRP4H; PRP4K; PRPF4B; Serine/threonine protein kinase PRP4 homolog ; Serine/threonine-protein kinase PRP4 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13523
-
Expression Region
581-680 aa
-
AA Sequence
PDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIG
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRPF4B (Pre-mRNA Processing Factor 4B) is a critical participant in the pre-mRNA splicing process, essential for the accurate processing of transcripts in eukaryotic cells. It is part of a complex network of spliceosomal components that facilitate the removal of introns from precursor mRNA. The dysfunction of splicing factors like PRPF4B has been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting its importance in maintaining cellular homeostasis and gene expression regulation. Recent advancements in protein engineering and recombinant DNA technology have enabled the production of PRPF4B as a recombinant protein, allowing for detailed structural and functional analyses. Studies using recombinant PRPF4B can elucidate its role in spliceosome assembly and interaction with other spliceosomal components, potentially revealing new therapeutic targets. Understanding the molecular mechanisms behind PRPF4B's function may also provide insights into the pathogenesis of splicing-related diseases, underscoring the relevance of this protein in both fundamental biology and medical research.
