Analytical Data
-
Gene name
RAB8A
- Application
-
Alternative Names
RAB8A；MEL；RAB8；Ras-related Protein Rab-8A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61006
-
Expression Region
6-176aa
-
AA Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
-
Molecular Weight
19.49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
RAB8A is a member of the RAB family of small GTPases, which play critical roles in regulating intracellular transport and membrane trafficking. It is primarily involved in the transport of vesicles, influencing processes like exocytosis and endocytosis. Dysregulation of RAB8A has been implicated in various pathological conditions, including cancer, neurodegenerative diseases, and developmental disorders. Research on RAB8A recombinant proteins has gained momentum due to their potential therapeutic relevance. Scientists are increasingly focused on characterizing its functional domains, understanding its interaction with effector proteins, and revealing its role in cellular processes. The production of RAB8A recombinant protein allows for in-depth studies of its biochemical properties and molecular mechanisms. Through these studies, researchers aim to uncover novel therapeutic targets and pathways, ultimately paving the way for new treatments that leverage the manipulation of RAB8A activity. Understanding the structure-function relationship of RAB8A through recombinant expression systems offers invaluable insights into its role in health and disease, making it a promising target for future biomedical research.
