Analytical Data
-
Gene name
C15orf26
- Application
-
Alternative Names
CFAP161; C15orf26Cilia- and flagella-associated Protein 161
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P656
-
Expression Region
1-199aa
-
AA Sequence
MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWNMKASPSRQMLKFSSITVTQIGDWQPTGIFS
-
Molecular Weight
49.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C15orf26, also known as "Chromosome 15 Open Reading Frame 26," is a relatively less characterized gene located on chromosome 15. Research into C15orf26 has gained attention due to its potential roles in various biological processes and disease mechanisms. Recent studies indicate that C15orf26 may be involved in cell proliferation, differentiation, and apoptosis, making it a candidate for understanding tumorigenesis and other pathological conditions. Additionally, genetic variations within the C15orf26 gene have been associated with certain cancers and developmental disorders, highlighting its relevance in medical genetics. Despite the accumulating evidence, much remains unknown about the specific functions and mechanisms of C15orf26. Recombinant protein studies are essential to elucidate the biochemical properties of C15orf26, including its expression patterns, structural characteristics, and functional interactions with other proteins. By generating and investigating C15orf26 recombinant proteins, researchers aim to determine its role in cellular pathways and its potential as a biomarker or therapeutic target. The ongoing exploration of C15orf26's biological significance could provide insights into its contribution to health and disease, paving the way for innovative strategies in diagnostics and treatment.
