Analytical Data
-
Gene name
C15orf21
- Application
-
Alternative Names
HMGN2P46; C15orf21; Putative Dresden prostate carcinoma Protein 2; D-PCa-2; High mobility group nucleosome-binding domain-containing Protein 2 pseudogene 46
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86SG4
-
Expression Region
1-172aa
-
AA Sequence
MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPSAYVPPLSLPPCPRERLKGMLKEIKPRLSRNCREDPQGCLLNLLLQSHSRSPERPLQRRERRYLQRRREKLMLARRGITLQKMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C15orf21, also known as chromosome 15 open reading frame 21, is a protein-coding gene located on chromosome 15 that has garnered attention due to its potential role in various biological processes and diseases. Research into C15orf21 has revealed its involvement in cellular functions such as cell proliferation, differentiation, and apoptosis, linking it to important pathways in human health. In recent years, studies have suggested that alterations in the expression or function of C15orf21 may be implicated in certain cancers and neurodevelopmental disorders, highlighting the need for further investigation. The recombinant expression of C15orf21 protein is crucial for elucidating its structure and function, allowing researchers to explore its mechanisms of action in disease contexts. By producing the protein in a controlled environment, scientists can perform functional assays, structural analysis, and interaction studies, contributing to a better understanding of its biological significance. Given the increasing evidence connecting C15orf21 to pathological conditions, the development of recombinant protein-based studies holds promise for uncovering therapeutic targets and biomarkers, ultimately aiding in the advancement of precision medicine approaches tailored to diseases associated with this gene.











