Analytical Data
-
Gene name
PTPRZ1
- Application
-
Alternative Names
PTPRZ1；HTPZP2；PTPRZ；PTPRZ2；Receptor-type tyrosine-Protein phosphatase zeta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23471
-
Expression Region
36-300aa
-
AA Sequence
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPRZ1 (Protein Tyrosine Phosphatase Receptor Type Z1) is a member of the receptor-type protein tyrosine phosphatase family, which plays a crucial role in cellular signaling pathways that regulate various biological processes, including cell differentiation, proliferation, and migration. This protein is primarily expressed in the central nervous system and has been implicated in neural development and synapse formation. Dysregulation of PTPRZ1 has been associated with several neurological disorders, including schizophrenia and neurodegenerative diseases, highlighting its importance in maintaining neuronal function. Recent research has focused on the generation of recombinant PTPRZ1 proteins to study their structural and functional properties, enabling a deeper understanding of their role in cellular communication. Utilizing techniques such as protein expression in bacterial or mammalian systems, researchers aim to produce purified PTPRZ1 for functional assays and crystallography studies, which could unveil potential therapeutic targets for diseases involving aberrant signaling pathways. Investigating the mechanisms by which PTPRZ1 influences cellular behavior remains a vital area of study, as it could lead to novel insights into therapeutic approaches for neurological disorders and the development of biotechnological applications based on its signaling capabilities.
