Analytical Data
-
Gene name
PTHLH
- Application
-
Alternative Names
PTHLH;PTHRP;Parathyroid hormone-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12272
-
Expression Region
37-175aa
-
AA Sequence
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
-
Molecular Weight
19.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTHLH (Parathyroid Hormone-like Peptide) is a crucial protein involved in various physiological processes, particularly in bone development and calcium homeostasis. Its role extends to the regulation of fetal bone growth and is implicated in conditions such as cancer metastasis to bone and certain skeletal dysplasias. The study of PTHLH recombinant proteins is pivotal for understanding its functional mechanisms, enabling researchers to explore therapeutic applications. Given that PTHLH shares structural similarities with parathyroid hormone (PTH), its recombinant form can be utilized to investigate receptor interactions and downstream signaling pathways. Furthermore, the ability to produce PTHLH in a recombinant form allows for detailed examination of its effects in both in vitro and in vivo models. This research not only contributes to the fundamental understanding of bone biology but also holds promise for developing targeted therapies for bone-related diseases. As research progresses, the insights gained from PTHLH recombinant proteins may lead to innovative approaches in treating endocrine disorders and bone pathologies, thereby enhancing clinical outcomes for patients affected by these conditions.











