Analytical Data
-
Gene name
SOST
- Application
-
Alternative Names
SOST；Sclerostin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQB4
-
Expression Region
24-213aa
-
AA Sequence
QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
-
Molecular Weight
25.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOST (sclerostin) is a glycoprotein primarily produced by osteocytes and plays a crucial role in bone metabolism and homeostasis. Its primary function is to inhibit the Wnt/β-catenin signaling pathway, which is essential for bone formation. Elevated levels of SOST are associated with conditions such as osteopenia and osteoporosis, making it a significant target for therapeutic interventions in bone-related diseases. Research has revealed that SOST is involved in various physiological processes, including bone remodeling and the regulation of bone density. Additionally, genetic studies have identified mutations in the SOST gene linked to sclerosteosis and van Buchem disease, highlighting its importance in bone density disorders. Given its regulatory role, recombinant SOST proteins are being explored as potential treatments to enhance bone formation or counteract bone density loss. Moreover, understanding the structure-function relationship of SOST and developing effective SOST inhibitors could open new avenues for therapies aiming to combat skeletal diseases and improve overall bone health. The exploration of SOST and its signaling pathways has significant implications not only for the understanding of bone biology but also for developing targeted treatments that can positively impact the quality of life for individuals with bone-related conditions.
