Cat: PA2000-2157

Recombinant Human POLR3A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POLR3A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POLR3A;DNA-directed RNA polymerase III subunit RPC1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14802

  • Expression Region

    392-632aa

  • AA Sequence

    FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC

  • Molecular Weight

    31.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POLR3A, or Polymerase III subunit A, is a crucial component of RNA polymerase III, the enzyme responsible for synthesizing various small non-coding RNAs, including tRNA, 5S rRNA, and other essential regulatory RNA molecules. As an integral part of the transcription machinery, POLR3A plays a significant role in gene expression regulation, cellular proliferation, and the synthesis of RNA required for protein translation. Recent studies have highlighted the importance of POLR3A in various biological processes, including immune response and tumorigenesis, making it a potential target for therapeutic intervention. Mutations or dysregulation of POLR3A have been linked to several diseases, including neurodegenerative disorders and cancers. The recombinant expression of POLR3A offers a valuable tool for studying its structure-function relationships and the mechanisms by which it interacts with other transcriptional factors and DNA. Moreover, understanding the biochemical properties and activity of POLR3A in vitro could provide insights into its role in pathological conditions and help in the development of novel strategies for disease treatment. Through the generation of POLR3A recombinant proteins, researchers can elucidate its function, explore potential post-translational modifications, and test inhibitor molecules, ultimately advancing our knowledge of this vital enzyme and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US