Analytical Data
-
Gene name
POU5F1
- Application
-
Alternative Names
POU5F1；OCT3；OCT4；OTF3；POU domain. class 5. transcription factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01860
-
Expression Region
1-360aa
-
AA Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
-
Molecular Weight
52.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POU5F1, also known as Oct4, is a critical transcription factor involved in the regulation of pluripotency and self-renewal in embryonic stem cells. Its expression is pivotal for maintaining the undifferentiated state of these cells, and it plays a significant role in early development. Research into POU5F1 has garnered attention for its potential applications in regenerative medicine, particularly in the fields of stem cell therapy and tissue engineering. As a key player in reprogramming somatic cells into induced pluripotent stem cells (iPSCs), POU5F1 serves as a foundational element in the quest to create patient-specific stem cell lines for therapeutic purposes. Studies have shown that the recombinant protein of POU5F1 can effectively modulate gene expression associated with stem cell characteristics, leading to advances in understanding stem cell biology and developmental processes. Furthermore, the investigation of POU5F1 and its interactions with other signaling pathways has important implications for cancer research, as aberrant expression of this factor is often linked to tumorigenesis. Therefore, the development and characterization of recombinant POU5F1 protein provide invaluable insights into both normal physiological processes and disease mechanisms, highlighting its importance as a target for therapeutic intervention.
