Analytical Data
-
Gene name
LY6H
- Application
-
Alternative Names
LY6H；Lymphocyte antigen 6H
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O94772
-
Expression Region
26-115aa
-
AA Sequence
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
-
Molecular Weight
11.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LY6H is a member of the Ly6/uPAR protein superfamily, which plays a crucial role in various biological processes, including cell signaling, immune responses, and neurodevelopment. Its expression is typically associated with specific cell types, particularly in the nervous system, and it has been implicated in the regulation of stem cell properties and differentiation. Research has indicated that LY6H may influence neuronal survival and plasticity, making it a potential candidate for studies related to neurodegenerative diseases and brain injuries. Moreover, its role in immune modulation positions LY6H as a relevant factor in understanding immune responses in various pathologies. Given these multifaceted roles, the study of LY6H recombinant protein is significant for unraveling its specific functions, interactions with other cellular components, and potential therapeutic applications. Investigating the structure-function relationship of this protein through recombinant expression systems can provide insights into its mechanisms of action and pave the way for novel strategies in treating neurological disorders and enhancing regenerative medicine approaches.
