Analytical Data
-
Gene name
POL30
- Application
-
Alternative Names
POL30；Proliferating cell nuclear antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15873
-
Expression Region
1-258aa
-
AA Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
-
Molecular Weight
30.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POL30, also known as PCNA (Proliferating Cell Nuclear Antigen), is a critical protein that plays a versatile role in DNA replication and repair mechanisms in eukaryotic cells. Serving as a sliding clamp, POL30 encircles DNA and recruits various proteins involved in replication, including DNA polymerases and repair factors. Its function is essential for maintaining genome stability, as it ensures the accurate and efficient replication of genetic material. The study of POL30 is particularly significant in the context of cancer research, as deregulation of its activities can lead to genomic instability and tumorigenesis. Furthermore, mutations in POL30 have been associated with various genetic disorders, highlighting its importance in cell survival and proliferation. With advancements in techniques such as CRISPR and structural biology, research into POL30 has expanded, providing deeper insights into its interactions and mechanisms at the molecular level. Understanding POL30’s structure and function not only enhances our comprehension of fundamental cellular processes but also holds potential for therapeutic interventions in diseases where DNA repair mechanisms are compromised.
