Cat: PA1000-5067

Recombinant Human RTBDN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RTBDN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RTBDN;Retbindin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BSG5

  • Expression Region

    31-229aa

  • AA Sequence

    SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCG VPSPECESFLEHLQR ALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGC EPSCLTYGQTFADGT DLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPR TSILDAAGSGSGSGS GSGPVDHHHHHH

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RTBDN (Regulator of Transcription and DNA Damage Response), a protein implicated in various cellular processes, has garnered significant attention in recent years due to its roles in regulating transcription and responding to DNA damage. As a crucial player in maintaining genomic stability, RTBDN is believed to facilitate the orchestration of molecular pathways that govern cell cycle progression, DNA repair mechanisms, and gene expression. Dysregulation of RTBDN has been associated with several diseases, including cancer, where it may contribute to aberrant cell proliferation and survival. Research has increasingly focused on elucidating the mechanistic functions of RTBDN and its interactions with other proteins involved in the DNA damage response. Understanding RTBDN's structure-function relationship and its regulatory mechanisms could pave the way for novel therapeutic strategies targeting its pathways, particularly in cancer treatment. Furthermore, studies utilizing recombinant RTBDN allow for the exploration of its biochemical properties, interaction networks, and functional domains in a controlled setting, providing vital insights into its contribution to cellular homeostasis and disease pathology. As research progresses, unraveling the complexities of RTBDN will be essential for developing targeted interventions that can enhance the body's ability to manage DNA damage and improve therapeutic outcomes for patients with related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US