Analytical Data
-
Gene name
PARP11
- Application
-
Alternative Names
PARP11；C12orf6；Protein mono-ADP-ribosyltransferase PARP11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR21
-
Expression Region
9-338aa
-
AA Sequence
FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
-
Molecular Weight
45.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PARP11, a member of the poly(ADP-ribose) polymerase (PARP) family, plays a critical role in cellular processes such as DNA repair, gene expression regulation, and cell signaling. Its unique structure distinguishes it from other PARP family members, which has led to increased interest in understanding its specific functions and implications in various biological contexts. Research has revealed that PARP11 is involved in the regulation of RNA metabolism and the response to cellular stresses. Dysregulation of PARP11 has been linked to several diseases, including cancer, neurodegeneration, and other pathologies, sparking interest in its potential as a therapeutic target. However, much remains unknown about its precise mechanisms of action and interactions within the cell. The recombinant expression of PARP11 allows researchers to investigate its biochemical properties, interaction partners, and regulatory mechanisms in a controlled environment. By studying PARP11 in detail, scientists aim to uncover its contributions to cellular homeostasis and to elucidate its role in disease progression, which could pave the way for novel strategies in disease treatment and prevention. As research advances, understanding PARP11's functions may lead to essential insights into the broader implications of PARP proteins in health and disease.
