Cat: PA1000-5068

Recombinant Human KNG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KNG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KNG1;BDK;KNG;Kininogen-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01042-2

  • Expression Region

    19-380aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHGNLYFQGGEFQESQSEEIDCNDKDLFKAVDA ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK TWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQ YDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQV VAGLNFRMTYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQL RIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKL NAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTES CETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMK

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KNG1, or Kininogen 1, is a multifaceted protein that plays a crucial role in the kinin-generating system, which is involved in various physiological processes, including inflammation, blood pressure regulation, and pain sensitization. The study of KNG1 recombinant proteins has gained significant attention due to its potential implications in understanding cardiovascular diseases, chronic pain, and other inflammatory conditions. Research has shown that KNG1 can influence bradykinin release, thereby modulating vascular permeability and contributing to the pathophysiology of various diseases. Additionally, mutations or variations in the KNG1 gene have been linked to altered susceptibility to certain diseases, making it a notable target for therapeutic intervention. The recombinant production of KNG1 allows for detailed functional studies, providing insights into its structure-function relationships and facilitating the development of KNG1-based drugs or biomaterials. Understanding the molecular mechanisms underlying KNG1's role in health and disease can pave the way for novel therapeutic strategies and enhance our comprehension of the complex biological pathways that govern inflammation and vascular health. Consequently, ongoing research into KNG1 recombinant proteins is crucial for elucidating their potential roles in clinical applications and advancing medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US