Analytical Data
-
Gene name
RETN
- Application
-
Alternative Names
RETN;FIZZ3;HXCP1;RSTN;Resistin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HD89
-
Expression Region
19-108aa
-
AA Sequence
KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
-
Molecular Weight
25.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RETN, or resistin, is a protein primarily produced by adipose tissue and is known for its role in insulin resistance and obesity-related pathologies. Research on RETN has accelerated in recent years due to its implications in metabolic disorders, including type 2 diabetes and cardiovascular diseases. It is classified as an adipokine, a type of cytokine secreted by adipose tissue that mediates various physiological functions. Elevated levels of RETN have been associated with inflammation and carbohydrate metabolism dysregulation, positioning it as a potential biomarker for assessing metabolic health. Studies have demonstrated that RETN can affect insulin signaling pathways, further complicating the metabolic profiles of individuals with obesity. Furthermore, RETN's involvement in inflammatory processes suggests that it may serve as a link between obesity and the development of chronic inflammatory diseases. Investigating RETN’s structural and functional properties through recombinant protein technology has provided insights into its biological mechanisms and interactions with other signaling pathways. This enhances our understanding of its role in metabolism and opens avenues for therapeutic interventions targeting RETN or its signaling pathways to combat obesity and its associated complications. Given the rising global prevalence of obesity and metabolic syndrome, continued research on RETN as a pivotal factor in these conditions is crucial for developing effective treatments and preventive strategies.











