Analytical Data
-
Gene name
OTX2
- Application
-
Alternative Names
OTX2；Homeobox Protein OTX2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32243
-
Expression Region
1-297aa
-
AA Sequence
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
-
Molecular Weight
48.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OTX2 (Orthodenticle Homeobox 2) is a critical transcription factor involved in various developmental processes, particularly in the regulation of neurogenesis and eye development. Mutations or dysregulation of OTX2 have been linked to several developmental disorders, including retinal degeneration and congenital eye malformations. Given its pivotal role in embryonic development and potential implications in regenerative medicine, there has been increasing interest in the characterization of OTX2 recombinant proteins. This research aims to produce OTX2 in a recombinant form to facilitate functional studies that can elucidate its molecular mechanisms and interactions with other proteins. Understanding the structure and function of OTX2 through recombinant protein studies can provide insights into its role in cellular processes, as well as its potential as a therapeutic target. By employing techniques such as molecular cloning, protein expression, and purification, researchers strive to generate high-quality OTX2 protein, which can be utilized in various assays, including binding studies and functional assays in cell cultures. This research not only contributes to the fundamental understanding of OTX2 but also paves the way for potential applications in treating conditions associated with OTX2 dysfunction.
