Analytical Data
-
Gene name
BTN3A2
- Application
-
Alternative Names
BTN3A2；BT3.2；BTF3；BTF4；Butyrophilin subfamily 3 member A2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78410
-
Expression Region
30-248aa
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQW SNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGL EKTASISIADPFFRSAQPWVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTN3A2, a member of the butyrophilin family, plays a crucial role in immune regulation and T cell activation. It is primarily expressed in antigen-presenting cells and has been implicated in the recognition of non-peptide antigens by γδ T cells, which are essential components of the immune system. Research has shown that BTN3A2 interacts with the Vγ9Vδ2 T cell receptor, stimulating these T cells to respond to various pathogens and tumors. Given its pivotal role in immune responses, BTN3A2 has garnered attention in cancer immunotherapy and infectious disease research. Recombinant BTN3A2 protein studies aim to elucidate its structure-function relationship, binding characteristics, and the mechanisms through which it activates γδ T cells. Investigating BTN3A2's properties may lead to novel strategies that harness the immune system to target malignancies or enhance responses to infections. Additionally, understanding BTN3A2's interactions with other immune components can provide insights into regulatory pathways that govern immune surveillance and tolerance, ultimately advancing therapeutic approaches in immunology.
