Analytical Data
-
Gene name
TXLNA
- Application
-
Alternative Names
TXLNA；TXLN；Alpha-taxilin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P40222
-
Expression Region
1-162aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGA QERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLE DILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVN GEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TXLNA, or Translin/Translin-Associated Factor X, is a multifunctional protein that has garnered significant attention in the field of molecular biology due to its involvement in various cellular processes, including RNA binding, signal transduction, and chromatin remodeling. Its role in neuronal development and potential implications in neurodegenerative diseases make it a focus of research. Studies have indicated that TXLNA participates in the formation of ribonucleoprotein complexes and is implicated in mRNA transport and stability, which are crucial for proper gene expression and cellular function. Moreover, TXLNA has been shown to interact with other proteins and nucleic acids, influencing pathways that regulate cell growth, apoptosis, and stress responses. The investigation of TXLNA recombinant protein not only aids in understanding its structural and functional properties but also provides insights into its mechanism of action and potential therapeutic applications. As researchers continue to explore the intricacies of TXLNA, its significance in both basic and applied sciences is becoming increasingly evident, highlighting the need for further investigations into its molecular interactions and biological roles.
