Analytical Data
-
Gene name
LRRC25
- Application
-
Alternative Names
LRRC25;MAPA;Leucine-rich repeat-containing Protein 25
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N386
-
Expression Region
21-165aa
-
AA Sequence
LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSG NGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHH HHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC25 (Leucine Rich Repeat Containing 25) is a gene that encodes a protein involved in various biological processes, including immune response and cellular signaling. Recent research has highlighted its potential role in the regulation of T cell activation and differentiation, making it a significant focus in immunology and cancer therapy. The study of LRRC25 recombinant proteins has gained traction as scientists seek to elucidate its function and interaction with other cellular components. By producing LRRC25 as a recombinant protein, researchers can investigate its structural properties and functional mechanisms, thus advancing our understanding of its involvement in immune modulation. Furthermore, the exploration of LRRC25's relationship with diseases, particularly those associated with immune dysregulation, could lead to novel therapeutic strategies. As the scientific community continues to unravel the complexities of immune system regulation, LRRC25 may emerge as a crucial player, providing insights into both fundamental biology and clinical applications.











