Analytical Data
-
Gene name
NPHS1
- Application
-
Alternative Names
NPHS1；NPHN；Nephrin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60500
-
Expression Region
23-257aa
-
AA Sequence
QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA
-
Molecular Weight
29.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPHS1, which encodes the nephrin protein, plays a crucial role in the formation and function of the slit diaphragm in the glomerulus, a vital component of the kidney filtration barrier. Mutations in the NPHS1 gene are associated with congenital nephrotic syndrome, leading to significant morbidity and early kidney failure in affected infants. Due to its importance in maintaining kidney function, NPHS1 has garnered considerable interest in the field of nephrology and molecular biology. Research into NPHS1 recombinant protein provides insights into its structural and functional properties, helping to elucidate the mechanisms of nephrin in kidney physiology and pathophysiology. By producing and studying NPHS1 recombinant proteins, scientists aim to develop potential therapeutic strategies for nephrotic syndrome and other kidney diseases. Furthermore, NPHS1's interactions with other proteins at the slit diaphragm highlight its critical role in podocyte biology, making it a key target for understanding glomerular diseases. This exploration may ultimately facilitate the development of new diagnostic tools and treatments, improving outcomes for patients suffering from kidney disorders associated with NPHS1 mutations.
