Analytical Data
-
Gene name
NR2F6
- Application
-
Alternative Names
NR2F6；EAR2；ERBAL2；Nuclear receptor subfamily 2 group F member 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10588
-
Expression Region
1-404aa
-
AA Sequence
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR2F6, also known as the nuclear receptor subfamily 2, group F, member 6, is a member of the nuclear receptor superfamily, which plays crucial roles in various biological processes, including development, metabolism, and immune responses. Research into NR2F6 has garnered significant attention due to its involvement in regulating gene expression and influencing cellular signaling pathways. Studies have indicated that NR2F6 may act as a transcriptional repressor, affecting the activity of several key genes involved in inflammation and immune regulation, thus suggesting its potential role in autoimmune diseases and cancer. The application of recombinant protein techniques to produce NR2F6 has enabled researchers to investigate its structural properties, functional mechanisms, and interactions with other molecular partners. Understanding NR2F6's biological functions is not only essential for elucidating its role in health and disease but also opens avenues for developing therapeutic strategies targeting this nuclear receptor. The characterization of NR2F6 as a recombinant protein facilitates high-throughput screening and functional assays that are instrumental in drug discovery and the development of novel treatments for conditions linked to dysregulated NR2F6 activity. As such, the study of NR2F6 recombinant protein is at the forefront of molecular biology and therapeutic innovation, highlighting its significance in current biomedical research.
