Analytical Data
-
Gene name
ESR1
- Application
-
Alternative Names
ESR1；ESR；NR3A1；Estrogen receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03372
-
Expression Region
315-551aa
-
AA Sequence
MVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ESR1, or Estrogen Receptor 1, is a member of the nuclear receptor superfamily, primarily involved in mediating the effects of estrogens on target genes and tissues. As a critical player in various physiological processes, including reproductive development, bone density regulation, and cardiovascular health, ESR1 has garnered significant attention in biomedical research. Dysregulation or mutation of ESR1 is linked to various diseases, particularly estrogen-dependent cancers such as breast cancer. The study of ESR1 recombinant proteins has emerged as a vital approach to understanding its structure-function relationship and the molecular mechanisms underlying its action. By producing recombinant ESR1 in model systems, researchers can investigate its binding affinity to estrogen and other ligands, dissect the transcriptional regulation pathways, and explore interactions with co-regulators and other signaling molecules. Additionally, the development of ESR1-targeted therapies, including selective estrogen receptor modulators (SERMs) and antagonists, has been accelerated through insights gained from recombinant protein studies. Ultimately, understanding ESR1's biological functions through recombinant technologies can facilitate the development of novel diagnostic and therapeutic strategies for estrogen-related disorders.
