Cat: PA2000-2130

Recombinant Human NPHP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPHP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPHP1;NPH1;Nephrocystin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15259

  • Expression Region

    1-109aa

  • AA Sequence

    MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENIT

  • Molecular Weight

    39.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The NPHP1 protein, associated with Nephronophthisis (NPHP), a genetic disorder leading to kidney dysfunction, has garnered significant attention in biological and medical research. NPHP1 encodes for a protein involved in the maintenance of renal tubular integrity and ciliogenesis, processes crucial for normal kidney function. Mutations in the NPHP1 gene are linked to kidney and extrarenal phenotypes, underscoring its role in disease manifestation. Understanding NPHP1 at the molecular level is vital for elucidating the mechanisms behind nephronophthisis and similar ciliopathies. Recent studies focus on the recombinant expression of NPHP1 protein, which allows researchers to investigate its structure-function relationships, interaction with other cellular proteins, and pathway involvements. By producing NPHP1 as a recombinant protein, scientists aim to dissect its functionalities, explore potential therapeutic strategies, and assess how its malfunction contributes to disease states. This research not only enhances our understanding of NPHP1’s role in kidney development and disease but also opens avenues for potential clinical interventions targeting renal pathologies linked to ciliopathies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US