Analytical Data
-
Gene name
NPHP1
- Application
-
Alternative Names
NPHP1；NPH1；Nephrocystin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15259
-
Expression Region
1-109aa
-
AA Sequence
MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENIT
-
Molecular Weight
39.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NPHP1 protein, associated with Nephronophthisis (NPHP), a genetic disorder leading to kidney dysfunction, has garnered significant attention in biological and medical research. NPHP1 encodes for a protein involved in the maintenance of renal tubular integrity and ciliogenesis, processes crucial for normal kidney function. Mutations in the NPHP1 gene are linked to kidney and extrarenal phenotypes, underscoring its role in disease manifestation. Understanding NPHP1 at the molecular level is vital for elucidating the mechanisms behind nephronophthisis and similar ciliopathies. Recent studies focus on the recombinant expression of NPHP1 protein, which allows researchers to investigate its structure-function relationships, interaction with other cellular proteins, and pathway involvements. By producing NPHP1 as a recombinant protein, scientists aim to dissect its functionalities, explore potential therapeutic strategies, and assess how its malfunction contributes to disease states. This research not only enhances our understanding of NPHP1’s role in kidney development and disease but also opens avenues for potential clinical interventions targeting renal pathologies linked to ciliopathies.
