Analytical Data
-
Gene name
ATG4A
- Application
-
Alternative Names
ATG4A；APG4A；AUTL2；Cysteine protease ATG4A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WYN0
-
Expression Region
1-398aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVW ILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLR CGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQ MAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIE DIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLR LGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDP HTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDF DNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDS TEQLEEFDLEEDFEILSV
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATG4A, or autophagy-related 4A, is a vital cysteine protease that plays a crucial role in the autophagy process, which is essential for cellular homeostasis, degradation of damaged organelles, and response to stress. This protein is one of the key regulators of the autophagic pathway, primarily responsible for the processing of LC3 (microtubule-associated protein 1 light chain 3), a pivotal marker for autophagosome formation. In recent years, research has highlighted the significance of ATG4A in various physiological and pathological contexts, including cancer, neurodegenerative diseases, and infections. Dysregulation of autophagy has been implicated in multiple diseases, making ATG4A a potential therapeutic target. An understanding of the structure and function of ATG4A is essential, as it could provide insights into the mechanisms underlying autophagy and its impact on health and disease. The recombinant expression of ATG4A allows researchers to study its activity, determine its enzymatic properties, and explore the molecular mechanisms governing its interaction with substrates and other autophagy-related proteins. By characterizing ATG4A, scientists aim to unravel its role in cellular processes and its potential as a drug target, thus contributing to the development of innovative strategies for treating autophagy-related diseases. This research area is particularly exciting due to the growing recognition of autophagy's role in aging and various diseases, making ATG4A a focal point for advancing therapeutic interventions and improving our understanding of cellular dynamics.
