Analytical Data
-
Gene name
SWSAP1
- Application
-
Alternative Names
SWSAP1;C19orf39;ATPase SWSAP1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NVH7
-
Expression Region
1-229aa
-
AA Sequence
MNHKVHHHHHHMPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLF LTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPA PSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMV ALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGL GPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SWSAP1, or Serine/Threonine-Protein Kinase SWSAP1, is a protein that's gaining attention in the field of molecular biology due to its potential roles in various cellular processes, including cell cycle regulation and signaling pathways. It is part of a larger group of serine/threonine kinases, which are known to modify proteins through phosphorylation, thereby influencing their activity and interactions. Researchers have been particularly interested in the role of SWSAP1 in disease mechanisms, notably in cancer, where dysregulation of kinase activity can lead to uncontrolled cell growth and proliferation. Previous studies suggest that SWSAP1 may be involved in tumorigenesis, but its specific functions and mechanisms remain poorly understood. The expression and purification of SWSAP1 as a recombinant protein is crucial for further biochemical and structural studies, allowing elucidation of its functional roles in cellular contexts. Understanding the structure-function relationship of SWSAP1 could provide insights into its potential as a therapeutic target. Thus, ongoing research aims to characterize SWSAP1 through various techniques, including crystallography and protein-protein interaction assays, to shed light on its biological significance and potential implications in targeted cancer therapies. This heightened focus on SWSAP1 underscores the importance of kinases in drug discovery and the development of novel therapeutic strategies.











