Analytical Data
-
Gene name
ABCB5
- Application
-
Alternative Names
ABCB5;ATP-binding cassette sub-family B member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2M3G0
-
Expression Region
141-247aa
-
AA Sequence
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMAIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQD IKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLP EVSLLKILKL NKPEWPFV
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABCB5, a member of the ATP-binding cassette (ABC) transporter family, has garnered significant attention in biomedical research due to its implications in multidrug resistance, particularly in cancer therapy. This protein functions primarily as a pump that expels various drugs and toxins from cells, thereby contributing to the survival of cancer cells in the presence of chemotherapeutic agents. Overexpression of ABCB5 has been identified in various malignancies, including melanoma and colorectal cancer, where it plays a critical role in maintaining stem cell-like properties and promoting tumorigenesis. Recent studies have focused on understanding the structure and function of recombinant ABCB5 proteins to elucidate their mechanisms of action and to identify potential inhibitors that could reverse drug resistance. The development of recombinant ABCB5 proteins allows researchers to explore their functional dynamics in vitro and in vivo, paving the way for novel therapeutic strategies aimed at overcoming drug resistance in cancer treatments. By targeting ABCB5, there is potential not only to enhance the efficacy of existing chemotherapy regimens but also to improve patient outcomes in drug-resistant cancers, marking a significant step forward in personalized medicine. This research area continues to evolve as scientists seek to unravel the complex interactions between ABCB5 and other molecular pathways involved in cancer progression and drug resistance.











