Analytical Data
-
Gene name
ZNF75A
- Application
-
Alternative Names
ZNF75A；Zinc finger Protein 75A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96N20
-
Expression Region
58-162aa
-
AA Sequence
SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVP QKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAR EKPFK
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF75A, or Zinc Finger Protein 75A, is a member of the zinc finger protein family, which plays a crucial role in various biological processes, including transcriptional regulation, cell differentiation, and apoptosis. Recent studies have indicated that ZNF75A is implicated in several diseases, particularly in cancer, where it may influence tumor progression and response to therapy. Understanding the structure and function of ZNF75A is essential for elucidating its biological roles and potential as a therapeutic target. The recombinant protein of ZNF75A is produced through techniques like recombinant DNA technology, allowing researchers to study its properties, interactions, and mechanisms of action in detail. By analyzing the recombinant ZNF75A, scientists aim to uncover its function in the context of normal cellular processes and disease pathways. Furthermore, investigating ZNF75A's interactions with other cellular proteins could lead to insights into its regulatory roles and potential involvement in gene expression networks. The study of ZNF75A, therefore, presents a significant opportunity to advance the understanding of zinc finger proteins and their contributions to health and disease.
