Analytical Data
-
Gene name
NKTR
- Application
-
Alternative Names
NKTR;NK-tumor recognition Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30414
-
Expression Region
10-175aa
-
AA Sequence
HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NKTR recombinant protein research centers on the development of innovative therapeutic agents designed to enhance the efficacy and specificity of treatments for various diseases, particularly cancer and autoimmune disorders. NKTR (Nektar Therapeutics) has pioneered the use of novel polymer-based drug conjugates that can effectively transform existing therapeutics into more potent and targeted therapies. The rationale behind this approach lies in the limitations of conventional drugs, which often exhibit poor solubility, rapid metabolism, and systemic toxicity. By engineering recombinant proteins that conjugate therapeutic agents with biodegradable polymers, NKTR aims to improve drug delivery, increase the half-life of therapeutic compounds, and minimize side effects. Research in this area also explores the potential for combination therapies, leveraging the synergistic effects of various agents to overcome resistance mechanisms in tumors. Current studies focus on optimizing the design and production of these recombinant proteins, assessing their pharmacokinetics, pharmacodynamics, and safety profiles in preclinical models. The overall goal is to facilitate the transition of these advanced therapeutic platforms into clinical applications, thus offering new hope for patients suffering from challenging diseases. Through ongoing research and development, NKTR is positioned at the forefront of biotechnology, aiming to redefine treatment paradigms and improve outcomes for diverse patient populations.











