Cat: PA1000-4991

Recombinant Human ZNF70 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF70

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNF70;Zinc finger Protein 70

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UC06

  • Expression Region

    1-446aa

  • AA Sequence

    MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKE IPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSD LSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFS QSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRE CGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGER PYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQR IHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSS LIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAF RHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNF70, a member of the zinc finger protein family, has garnered significant attention in recent years due to its potential roles in various biological processes, including gene regulation, cell differentiation, and apoptosis. The presence of multiple zinc finger motifs allows ZNF70 to bind DNA and interact with other proteins, making it a key player in transcriptional regulation. Research has indicated that dysregulation of ZNF70 may be implicated in several diseases, including cancer and developmental disorders. To better understand its functions, researchers have started to produce recombinant ZNF70 proteins, which facilitate the study of its structural properties and interactions in vitro. The generation of these recombinant proteins enables scientists to investigate the molecular mechanisms underlying ZNF70's involvement in gene expression and its potential as a therapeutic target. Additionally, the analysis of ZNF70's interaction with specific DNA sequences and protein partners can provide insights into its role in cellular processes and disease pathways, contributing to the broader understanding of zinc finger proteins in cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US