Cat: PA2000-2106

Recombinant Human MT-CO1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MT-CO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MT-CO1;COI;COXI;MTCO1;Cytochrome c oxidase subunit 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00395

  • Expression Region

    474-513aa

  • AA Sequence

    EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

  • Molecular Weight

    17.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MT-CO1, or mitochondrial cytochrome c oxidase subunit 1, is a crucial component of the mitochondrial respiratory chain, playing a significant role in energy production through oxidative phosphorylation. This protein is encoded by mitochondrial DNA, which is inherited maternally, making it a valuable marker in phylogenetic studies and evolutionary biology. The study of MT-CO1 has expanded beyond basic biology to applications in numerous fields, including conservation genetics, where it aids in species identification and biodiversity assessments through DNA barcoding. Furthermore, variations and mutations in the MT-CO1 gene have been implicated in various mitochondrial diseases, contributing to the understanding of pathophysiological mechanisms. Researchers have focused on recombinant production of MT-CO1 to facilitate detailed structure-function analyses and to develop potential therapeutic interventions for mitochondrial disorders. By expressing and purifying this protein, scientists can investigate its interactions, enzymatic activity, and role within the larger context of the respiratory chain. This research not only enhances our understanding of mitochondrial functions but also holds promise for advancements in biomedical applications, including gene therapy and regenerative medicine. The growing interest in MT-CO1 reflects its integral role in both fundamental and applied biological research, underscoring the importance of this protein in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US