Analytical Data
-
Gene name
MT-CO1
- Application
-
Alternative Names
MT-CO1;COI;COXI;MTCO1;Cytochrome c oxidase subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00395
-
Expression Region
474-513aa
-
AA Sequence
EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
-
Molecular Weight
17.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT-CO1, or mitochondrial cytochrome c oxidase subunit 1, is a crucial component of the mitochondrial respiratory chain, playing a significant role in energy production through oxidative phosphorylation. This protein is encoded by mitochondrial DNA, which is inherited maternally, making it a valuable marker in phylogenetic studies and evolutionary biology. The study of MT-CO1 has expanded beyond basic biology to applications in numerous fields, including conservation genetics, where it aids in species identification and biodiversity assessments through DNA barcoding. Furthermore, variations and mutations in the MT-CO1 gene have been implicated in various mitochondrial diseases, contributing to the understanding of pathophysiological mechanisms. Researchers have focused on recombinant production of MT-CO1 to facilitate detailed structure-function analyses and to develop potential therapeutic interventions for mitochondrial disorders. By expressing and purifying this protein, scientists can investigate its interactions, enzymatic activity, and role within the larger context of the respiratory chain. This research not only enhances our understanding of mitochondrial functions but also holds promise for advancements in biomedical applications, including gene therapy and regenerative medicine. The growing interest in MT-CO1 reflects its integral role in both fundamental and applied biological research, underscoring the importance of this protein in health and disease.











