Analytical Data
-
Gene name
IL-9
- Application
-
Alternative Names
IL-9；Interleukin-9 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15248
-
Expression Region
19-144aa
-
AA Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
-
Molecular Weight
15.16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-9 (IL-9) is a cytokine primarily produced by T-helper 2 (Th2) cells and has been implicated in various immunological processes, including allergic responses, asthma, and certain autoimmune diseases. Its role in promoting IgE synthesis and enhancing mast cell proliferation and survival highlights its significance in allergic inflammation. In recent years, researchers have focused on recombinant IL-9 protein for its potential therapeutic applications. Recombinant IL-9 can be utilized to understand the underlying mechanisms of Th2-mediated diseases and to develop targeted treatments for conditions such as asthma and other allergic disorders. Furthermore, IL-9's interactions with other immune cells, including its effects on dendritic cells and T-regulatory cells, underscore its complexity in modulating immune responses. By studying recombinant IL-9, scientists aim to uncover new pathways for intervention and to explore its role in tumor immunity, as IL-9 has also been shown to influence tumor progression in some cancers. The development of IL-9-based therapies could offer novel strategies for managing immune-related diseases and improving patient outcomes. Therefore, the investigation of recombinant IL-9 protein continues to be a valuable frontier in immunological research, with important implications for both therapeutic innovation and understanding of immune regulation.
