Analytical Data
-
Gene name
INSL4
- Application
-
Alternative Names
INSL4；Early placenta insulin-like peptide
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14641
-
Expression Region
26-139aa
-
AA Sequence
AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKD GQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCC EVICDDGTSVKLCT
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INSL4, or Insulin-Like 4, is a member of the insulin superfamily that has garnered attention for its potential roles in reproductive biology and various metabolic processes. Initially identified in the placenta, INSL4 is believed to be involved in early pregnancy maintenance and the regulation of fetal growth. Its expression is primarily localized to trophoblast cells, highlighting its significance in placentation. Recent studies have suggested that INSL4 may also play a role in endocrine functions, with implications for conditions such as obesity and type 2 diabetes. Given its structural similarity to insulin, researchers are exploring its biological activities and signaling pathways to better understand its influence on glucose metabolism and reproductive health. The development of recombinant INSL4 proteins has enabled detailed investigations into its functional mechanisms, offering new insights into its therapeutic potential. Moreover, studying INSL4 and its interactions could pave the way for novel approaches in treating reproductive disorders and metabolic diseases. As research progresses, a clearer picture of INSL4’s diverse roles in human health and disease is emerging, making it a promising target for further investigation.
