Analytical Data
-
Gene name
EGR1
- Application
-
Alternative Names
EGR1；KROX24；ZNF225；Early growth response Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18146
-
Expression Region
282-433aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTS YQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDE RKRHTKIHLRQKDKKADKSVVAS
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EGR1, or Early Growth Response 1, is a crucial immediate early gene that plays a significant role in various cellular processes, including proliferation, differentiation, and apoptosis. It is a zinc-finger transcription factor that is rapidly activated in response to extracellular stimuli such as growth factors, mitogens, and stress signals. Due to its pivotal role in cell signaling pathways, EGR1 has been implicated in numerous physiological and pathological contexts, including embryonic development, neurogenesis, immune responses, and tumorigenesis. The study of EGR1 recombinant protein is essential for understanding its functional mechanisms and interactions at the molecular level. By producing EGR1 as a recombinant protein, researchers can investigate its binding affinity to various DNA sequences, elucidate its role in gene regulation, and identify potential post-translational modifications that may influence its activity. Additionally, recombinant EGR1 protein can be utilized in the development of targeted therapies, as its dysregulation is often associated with diseases such as cancer and neurological disorders. Exploring the structural and functional characteristics of EGR1 through recombinant protein studies holds promise for advancing therapeutic strategies and deepening our understanding of EGR1's contributions to health and disease.
