Analytical Data
-
Gene name
MRPL12
- Application
-
Alternative Names
MRPL12；MRPL7；RPML12；Large ribosomal subunit Protein bL12m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52815
-
Expression Region
1-198aa
-
AA Sequence
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL12, a mitochondrial ribosomal protein, plays a crucial role in mitochondrial protein synthesis and is essential for maintaining mitochondrial function and cellular energy metabolism. Mitochondria are vital organelles responsible for ATP production, and dysfunction in their biogenesis and protein synthesis can lead to various diseases, including neurodegenerative disorders and metabolic syndromes. Studies on MRPL12 have shown its involvement in the mitochondrial translation process, where it aids in the assembly of mitochondrial ribosomes and influences the synthesis of mitochondrial-encoded proteins. Moreover, aberrations in the expression or function of MRPL12 have been implicated in the pathology of certain cancers and mitochondrial diseases, highlighting the importance of understanding its structural and functional characteristics. Research into MRPL12 recombinantly can provide valuable insights into its biochemical properties, interactions with other mitochondrial components, and its potential as a therapeutic target. By elucidating the specific mechanisms through which MRPL12 contributes to mitochondrial function and cellular homeostasis, scientists hope to uncover novel approaches for treating diseases linked to mitochondrial dysfunction. Overall, the study of MRPL12 offers a promising avenue for advancing our knowledge of mitochondrial biology and developing interventions for mitochondrial-related diseases.
