Analytical Data
-
Gene name
manA
- Application
-
Alternative Names
manA;PMI1;Mannose-6-phosphate isomerase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00946
-
Expression Region
1-391aa
-
AA Sequence
MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEAKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWKGSQQLQLKPGESAFIAANESPVTVKGHGRLARVYNKL
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The manipulation and study of recombinant proteins have become a cornerstone of modern molecular biology and biotechnology, with particular emphasis on the manA gene, which encodes for mannose-6-phosphate isomerase (MPI). This enzyme plays a critical role in the mannose metabolism pathway, catalyzing the conversion of mannose-6-phosphate to fructose-6-phosphate, and is vital for proper glycoprotein synthesis. Research on manA recombinant proteins aims to better understand the enzyme's structure, function, and interaction with other cellular components. These studies are essential for elucidating the biological significance of mannose metabolism in various organisms and its implications in human diseases, including metabolic disorders and cancer. Additionally, recombinant manA proteins offer potential applications in therapeutic development, including the engineering of glycoproteins for improved pharmacological properties. Furthermore, advances in recombinant DNA technology facilitate the expression and purification of manA proteins in various host systems, providing an invaluable tool for biochemical and pharmacological studies. As a result, research on manA recombinant proteins not only enhances our fundamental understanding of enzymatic processes but also opens avenues for innovative medical treatments, highlighting the importance of this area of study in both basic and applied sciences.











